Basic Information | |
---|---|
Taxon OID | 3300009538 Open in IMG/M |
Scaffold ID | Ga0129287_10501043 Open in IMG/M |
Source Dataset Name | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2W |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Delaware |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 546 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater → Microbial Role In Biogeochemical Cycling In A Beach Aquifer System |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Cape Shores, Lewes, Delaware, USA | |||||||
Coordinates | Lat. (o) | 38.7855 | Long. (o) | -75.1045 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036104 | Metagenome / Metatranscriptome | 170 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0129287_105010431 | F036104 | AGGGGG | MEQQGIPLSIGIIIAAAVIGATFIAGMALMAILSALK* |
⦗Top⦘ |