Scaffold Ga0129284_10245869

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0129284_10245869

Scaffold Ga0129284_10245869

Overview

Basic Information
Taxon OID	3300009514 Open in IMG/M
Scaffold ID	Ga0129284_10245869 Open in IMG/M
Source Dataset Name	Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1W
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Delaware
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	800
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater → Microbial Role In Biogeochemical Cycling In A Beach Aquifer System

Source Dataset Sampling Location
Location Name	Cape Shores, Lewes, Delaware, USA
Coordinates	Lat. (^o)	38.7855	Long. (^o)	-75.1045	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090867	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0129284_102458692	F090867	GGA	MHGQGGGFMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACTQTTDGFMSYLGGGRID*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.