NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F090867

Metagenome Family F090867

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090867
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 73 residues
Representative Sequence MNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV
Number of Associated Samples 90
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.26 %
% of genes near scaffold ends (potentially truncated) 25.00 %
% of genes from short scaffolds (< 2000 bps) 75.00 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.481 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(12.037 % of family members)
Environment Ontology (ENVO) Unclassified
(54.630 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(67.593 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.35%    β-sheet: 0.00%    Coil/Unstructured: 48.65%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF13481AAA_25 10.19
PF12850Metallophos_2 2.78
PF13730HTH_36 2.78
PF03796DnaB_C 1.85
PF14549P22_Cro 1.85
PF13518HTH_28 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 1.85
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 1.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.15 %
UnclassifiedrootN/A1.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10033427All Organisms → Viruses → Predicted Viral2791Open in IMG/M
3300000101|DelMOSum2010_c10081571All Organisms → Viruses → Predicted Viral1430Open in IMG/M
3300000101|DelMOSum2010_c10166131All Organisms → cellular organisms → Bacteria → Proteobacteria785Open in IMG/M
3300000101|DelMOSum2010_c10193397All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium691Open in IMG/M
3300000101|DelMOSum2010_c10260251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300000101|DelMOSum2010_c10283492All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300000115|DelMOSum2011_c10083654All Organisms → cellular organisms → Bacteria → Proteobacteria1099Open in IMG/M
3300000116|DelMOSpr2010_c10012989All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4247Open in IMG/M
3300000116|DelMOSpr2010_c10026566All Organisms → cellular organisms → Bacteria → Proteobacteria2749Open in IMG/M
3300000116|DelMOSpr2010_c10228709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium578Open in IMG/M
3300001352|JGI20157J14317_10002821All Organisms → cellular organisms → Bacteria → Proteobacteria14392Open in IMG/M
3300003580|JGI26260J51721_1007920All Organisms → cellular organisms → Bacteria → Proteobacteria3072Open in IMG/M
3300004461|Ga0066223_1138045All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300005590|Ga0070727_10233021All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1029Open in IMG/M
3300005601|Ga0070722_10014666All Organisms → cellular organisms → Bacteria2415Open in IMG/M
3300005612|Ga0070723_10311757All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium745Open in IMG/M
3300006165|Ga0075443_10005972All Organisms → cellular organisms → Bacteria → Proteobacteria4404Open in IMG/M
3300006752|Ga0098048_1009942All Organisms → Viruses → Predicted Viral3401Open in IMG/M
3300006793|Ga0098055_1046478All Organisms → Viruses → Predicted Viral1760Open in IMG/M
3300006810|Ga0070754_10477261All Organisms → cellular organisms → Bacteria → Proteobacteria538Open in IMG/M
3300006916|Ga0070750_10277230All Organisms → cellular organisms → Bacteria → Proteobacteria722Open in IMG/M
3300006919|Ga0070746_10138226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1193Open in IMG/M
3300006919|Ga0070746_10258104All Organisms → cellular organisms → Bacteria → Proteobacteria811Open in IMG/M
3300007540|Ga0099847_1177657All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300007540|Ga0099847_1177659All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300007540|Ga0099847_1189777All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium602Open in IMG/M
3300007550|Ga0102880_1144368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300007655|Ga0102825_1061312All Organisms → cellular organisms → Bacteria → Proteobacteria765Open in IMG/M
3300007900|Ga0111031_1129325All Organisms → Viruses → Predicted Viral1513Open in IMG/M
3300009024|Ga0102811_1158715All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium846Open in IMG/M
3300009076|Ga0115550_1067203All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1406Open in IMG/M
3300009079|Ga0102814_10654646All Organisms → cellular organisms → Bacteria → Proteobacteria576Open in IMG/M
3300009136|Ga0118735_10002438All Organisms → cellular organisms → Bacteria → Proteobacteria6481Open in IMG/M
3300009436|Ga0115008_10303841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1132Open in IMG/M
3300009441|Ga0115007_10062396All Organisms → Viruses → Predicted Viral2340Open in IMG/M
3300009442|Ga0115563_1192121All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium790Open in IMG/M
3300009467|Ga0115565_10384572All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium634Open in IMG/M
3300009497|Ga0115569_10066688All Organisms → Viruses → Predicted Viral1916Open in IMG/M
3300009507|Ga0115572_10541543All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium643Open in IMG/M
3300009512|Ga0115003_10054651All Organisms → Viruses → Predicted Viral2521Open in IMG/M
3300009514|Ga0129284_10245869Not Available800Open in IMG/M
3300010149|Ga0098049_1096780All Organisms → cellular organisms → Bacteria → Proteobacteria925Open in IMG/M
3300010430|Ga0118733_101921294All Organisms → cellular organisms → Bacteria → Proteobacteria1177Open in IMG/M
3300010430|Ga0118733_102800208All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium961Open in IMG/M
3300010430|Ga0118733_105366395All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium676Open in IMG/M
3300010883|Ga0133547_11707913All Organisms → cellular organisms → Bacteria → Proteobacteria1169Open in IMG/M
3300011118|Ga0114922_10057376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3389Open in IMG/M
3300011126|Ga0151654_1092982All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300011253|Ga0151671_1073008All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3841Open in IMG/M
3300011254|Ga0151675_1124885All Organisms → cellular organisms → Bacteria → Proteobacteria579Open in IMG/M
3300011256|Ga0151664_1162285All Organisms → cellular organisms → Bacteria → Proteobacteria613Open in IMG/M
3300011258|Ga0151677_1104263All Organisms → cellular organisms → Bacteria → Proteobacteria1615Open in IMG/M
3300011261|Ga0151661_1031069All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300017706|Ga0181377_1060051All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium707Open in IMG/M
3300017719|Ga0181390_1034773All Organisms → Viruses → Predicted Viral1554Open in IMG/M
3300017735|Ga0181431_1004215All Organisms → cellular organisms → Bacteria → Proteobacteria3700Open in IMG/M
3300018416|Ga0181553_10135545All Organisms → cellular organisms → Bacteria → Proteobacteria1481Open in IMG/M
3300018417|Ga0181558_10374096All Organisms → cellular organisms → Bacteria → Proteobacteria761Open in IMG/M
3300018420|Ga0181563_10133186All Organisms → Viruses → Predicted Viral1584Open in IMG/M
3300020169|Ga0206127_1035156All Organisms → cellular organisms → Bacteria → Proteobacteria2793Open in IMG/M
3300021185|Ga0206682_10112379All Organisms → Viruses → Predicted Viral1333Open in IMG/M
3300021347|Ga0213862_10081548All Organisms → cellular organisms → Bacteria → Proteobacteria1142Open in IMG/M
3300021371|Ga0213863_10359289All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300022053|Ga0212030_1033003All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium722Open in IMG/M
3300022053|Ga0212030_1065174All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300022164|Ga0212022_1030814All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium822Open in IMG/M
3300022169|Ga0196903_1005519All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1646Open in IMG/M
3300022206|Ga0224499_10207369All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium667Open in IMG/M
3300022218|Ga0224502_10381162All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
(restricted) 3300023112|Ga0233411_10006433All Organisms → Viruses → Predicted Viral3336Open in IMG/M
(restricted) 3300023210|Ga0233412_10532549Not Available532Open in IMG/M
(restricted) 3300023276|Ga0233410_10066009All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1095Open in IMG/M
(restricted) 3300024062|Ga0255039_10026412All Organisms → Viruses → Predicted Viral2096Open in IMG/M
(restricted) 3300024340|Ga0255042_10078583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium887Open in IMG/M
3300024348|Ga0244776_10679765All Organisms → cellular organisms → Bacteria → Proteobacteria638Open in IMG/M
(restricted) 3300024518|Ga0255048_10448017All Organisms → cellular organisms → Bacteria → Proteobacteria625Open in IMG/M
(restricted) 3300024519|Ga0255046_10078688All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1362Open in IMG/M
(restricted) 3300024520|Ga0255047_10102017All Organisms → Viruses → Predicted Viral1474Open in IMG/M
(restricted) 3300024529|Ga0255044_10252155All Organisms → cellular organisms → Bacteria → Proteobacteria709Open in IMG/M
(restricted) 3300024529|Ga0255044_10404524All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300025085|Ga0208792_1005076All Organisms → cellular organisms → Bacteria → Proteobacteria3374Open in IMG/M
3300025098|Ga0208434_1015502All Organisms → cellular organisms → Bacteria → Proteobacteria1989Open in IMG/M
3300025508|Ga0208148_1002280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium6867Open in IMG/M
3300025620|Ga0209405_1000385All Organisms → cellular organisms → Bacteria → Proteobacteria37282Open in IMG/M
3300025640|Ga0209198_1023304All Organisms → cellular organisms → Bacteria → Proteobacteria2751Open in IMG/M
3300025759|Ga0208899_1107049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1031Open in IMG/M
3300027226|Ga0208309_1046038All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300027672|Ga0209383_1019242All Organisms → cellular organisms → Bacteria → Proteobacteria2972Open in IMG/M
3300027833|Ga0209092_10071877All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2094Open in IMG/M
3300027833|Ga0209092_10082988All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1924Open in IMG/M
3300027833|Ga0209092_10086079All Organisms → Viruses → Predicted Viral1884Open in IMG/M
3300027845|Ga0209271_10075347All Organisms → cellular organisms → Bacteria → Proteobacteria1399Open in IMG/M
(restricted) 3300027996|Ga0233413_10415176All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
(restricted) 3300028045|Ga0233414_10604903All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300028125|Ga0256368_1002563All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2556Open in IMG/M
3300028284|Ga0257120_1005212All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium6480Open in IMG/M
3300031519|Ga0307488_10085431All Organisms → Viruses → Predicted Viral2336Open in IMG/M
3300031569|Ga0307489_11025834All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
3300031774|Ga0315331_10822177All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300032258|Ga0316191_10152375All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1690Open in IMG/M
3300032272|Ga0316189_10503143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium932Open in IMG/M
3300032274|Ga0316203_1064477All Organisms → cellular organisms → Bacteria → Proteobacteria1047Open in IMG/M
3300032277|Ga0316202_10051217All Organisms → Viruses → Predicted Viral1938Open in IMG/M
3300032277|Ga0316202_10130813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1164Open in IMG/M
3300032277|Ga0316202_10187092All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium961Open in IMG/M
3300032373|Ga0316204_11015280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300033429|Ga0316193_10058374All Organisms → Viruses → Predicted Viral3003Open in IMG/M
3300033742|Ga0314858_046790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1040Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.04%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.04%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine9.26%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment7.41%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater6.48%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.48%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater6.48%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.56%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat4.63%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine2.78%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.78%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.78%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow1.85%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.85%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.85%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.85%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.85%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.85%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.85%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.93%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.93%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment0.93%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.93%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.93%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.93%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.93%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300003580Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNAEnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005601Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300007900Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf. Combined Assembly of MM1PM1EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009136Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsfEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009514Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1WEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011126Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011254Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300011256Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, totalEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300011261Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022206Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024340 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5EnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300027226Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027845Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300028284Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1003342763300000101MarineMNFNDGMERKVRKLLDHTQLNNSEIAEAIGVHRQDIERFVRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV*
DelMOSum2010_1008157133300000101MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV*
DelMOSum2010_1016613133300000101MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQTTDGFMYYLGGGRID*
DelMOSum2010_1019339723300000101MarineMNFNDGMERKVRKLLDHTQLNNSEIAEAIGVHRQDIERFVRRRNEPASLSDEELAXTQPTDGFLYYLRGGNDGV*
DelMOSum2010_1026025123300000101MarineMNFNDGMTRKMIKLLDHTELNYSEIAEAVGAHRQDVERFVRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV*
DelMOSum2010_1028349223300000101MarineMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACTQTTDGFMSYLGGGRID*
DelMOSum2011_1008365423300000115MarineMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIXRFKRRXNEPTSLSDEELACTQTTDGFMSYLGGGRID*
DelMOSpr2010_1001298983300000116MarineMKLSDGMERRMIKLLDHTELNYTEIAEAVGVHRQEVEKFVRRRSEGTSLSDEELACTQCSEGFLYYLRGGNDDRV*
DelMOSpr2010_1002656613300000116MarineMKLNDGMERKMIKLLDHTELTYTEIAEAVGVHREEVEKFVRRRTEGTSLSEEELGCTQCSEGFLYYLRGGNDDRV*
DelMOSpr2010_1022870923300000116MarineMRLSDGMERRMIKLLDHTELTYSEIAEAVGVHRQEVDKFVRRRTEGTSLSDEELACTQCSEGFLYYLRGGNDDRV*
JGI20157J14317_1000282123300001352Pelagic MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPISLSDEELACTQPTDGFMLYLGGGRID*
JGI26260J51721_100792043300003580MarineMIFNDGMERKVRKLLDHTQLTDSEIAEAMGVHRQDIERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGI*
Ga0066223_113804523300004461MarineMNFNDGMERKVRKLLDHTQLTDSEIAEAIGVHRQDIERFKRRRNEPTSLSDEELACTQPTDGFLYYLRG
Ga0070727_1023302143300005590Marine SedimentMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPKSLSDEELACTQTTDGFM
Ga0070722_1001466643300005601Marine SedimentMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACTQTTDGFMAYLGGGRID*
Ga0070723_1031175723300005612Marine SedimentMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPKSLSDEELACTQTTDGFMFYLGGGRID*
Ga0075443_1000597243300006165MarineMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVNRQDIERFKRRRNEPVSLCDEELACTQTTNGFMSYLRGGNDGI*
Ga0098048_100994243300006752MarineMKLSDGMERRMIKLLDHTELNYTEIAEAVGVHRQEVDKFVRRRTEGTSLSDEELACTQCSEGFLYYLRGGNDDRV*
Ga0098055_104647843300006793MarineMKLSDGMERRMIKLLDHTELNYTEIAEAVGVHRQEVEKFVRRRTEGTSLSDEELACTQCSEGFLYYLRGGNDDRV*
Ga0070754_1047726113300006810AqueousRIMRLSDGMERRMIKLLDHTELTYSEIAEAVGVHRQEVDKFVRRRTEGTSLSDEELACTQCSEGFLYYLRGGNDDRV*
Ga0070750_1027723023300006916AqueousMRLNDGMQRKMIKLLDHTELNYREIAEAVGVHRRDVEKFVRRRTEGTSLSEEELGCTQCTEGFLYYLRGGNDDRV*
Ga0070746_1013822633300006919AqueousMKLNDGMQRKMIKLLDHTELTYTEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELGCTQCSEGFLYYLRGGNDDRV*
Ga0070746_1025810423300006919AqueousMKLNDGMQRKMIKLLDHTELTYSEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELGCTQCSEGFLYYLRGGNDDRV*
Ga0099847_117765713300007540AqueousMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGI*
Ga0099847_117765913300007540AqueousMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGND*
Ga0099847_118977723300007540AqueousMNFNDGMERKVRKLLDHTQLNNSEIAEAIGVHRQDIERFVRRRNEPTSLSDEELACTQTTDGFMSYLGGGRID*
Ga0102880_114436823300007550EstuarineMRLNDGMERRMIKLLDHTELTNTEIAEAVGIHRQDVEKFKRRRNELTTLSDEELACTQPTDGFLYYLRGGNDDRV*
Ga0102825_106131213300007655EstuarineGIMIFNDGMERKVRKLLDHTQLTDSEIAEAMGVHRQDIERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGI*
Ga0111031_112932533300007900Marine SedimentMNFNDGMERKVRKLLDHTQLTDSEIAEAIGVHRQDIERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV*
Ga0102811_115871523300009024EstuarineMRLSDGMERRMIKLLDHTELTNTEIAEAVGIHRQDVEKFKRRRNELTTLSDEELACTQPTDGFLYYLRGGNDDRV*
Ga0115550_106720333300009076Pelagic MarineMNFNDGMEKKVRKLLDHTSMTNTEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACTQTTDGFMSYLGGGRID*
Ga0102814_1065464623300009079EstuarineNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDDRV*
Ga0118735_1000243833300009136Marine SedimentMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVEKFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV*
Ga0115008_1030384123300009436MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVEKFKRRRNEPKSLSDEELACTQPTDGFLYYLRGGNDGV*
Ga0115007_1006239643300009441MarineMNFNDGMERKVRKLLDHTQLNNSEIAEAIGVNRQDIERFVRRRNEPVSLSDEELACTQPSDGFLYYLRGGNDGV*
Ga0115563_119212133300009442Pelagic MarineMNFNDGMERKVRKLLDHTQLNNSEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV*
Ga0115565_1038457213300009467Pelagic MarineMNFNDGMERKVRKLLDHTQLNNSEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACTQTTDGFMS
Ga0115569_1006668823300009497Pelagic MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPISLSDEELACTQPTDGFLYYLRGGNDGV*
Ga0115572_1054154323300009507Pelagic MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPISLSDEELACTQPTDGFMLYLG
Ga0115003_1005465123300009512MarineMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPVSLSDEELACTQTTDGFMSYLGGGRID*
Ga0129284_1024586923300009514Beach Aquifer PorewaterMHGQGGGFMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACTQTTDGFMSYLGGGRID*
Ga0098049_109678013300010149MarineLLDHTELNYTEIAEAVGVHRQEVEKFVRRRTEGTSLSDEELACTQCSEGFLYYLRGGNDDRV*
Ga0118733_10192129413300010430Marine SedimentGFMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACTQTTDGFMSYLGGGRID*
Ga0118733_10280020823300010430Marine SedimentMKLSDGMERRMMKLLDHTELNYTEIAEAVGVHRREVEKFVRRRTEGVSLSDEELACTQCSEGFLYYLQGGNDDRV*
Ga0118733_10536639533300010430Marine SedimentMNFNDGMERKVRKLLDHTQLNNSEIAEAIGVHRQDIERFVRRRNEPVSLSDEELACTQPSDGFLYYLRGGNDGV*
Ga0133547_1170791313300010883MarineGRGIMIFNDGMERKVRKLLDHTQLTDSEIAEAIGVNRQDIERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV*
Ga0114922_1005737643300011118Deep SubsurfaceMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACNQTTDGFMSYLGGGRID*
Ga0151654_109298213300011126MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFQRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGI*
Ga0151671_107300843300011253MarineMKLSDGMERRMIKLLDHTELNYTEISEAVGVHRQEVEKFVRRRSEGTSLSDEELACTQCSEGFLYYLRGGNDDRV*
Ga0151675_112488523300011254MarineMKLSDGMERRMIKLLDHTELNYTEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELACTQCSEGFLYYLRGGNDDRV*
Ga0151664_116228513300011256MarineMRLSDGMERRMIKLLDHTELTNTEIAEAVGIHRQDVEKFKRRRNELTTLSEEELACTQPTDGFLYYLTGGNDDRV*
Ga0151677_110426333300011258MarineMRLSDGMERRMIKLLDHTGLHYIGIAEAVGVHRQEVEKFVRRRTEGVSLSDGELACTQCSEGFWYYLRGGNDDRV*
Ga0151661_103106913300011261MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHLQDVERFKRRRNELTSLSDAELACTQPTDGFLYYLGGGRID*
Ga0181377_106005113300017706MarineMRLNDGMERKMIKLLDHTELTYTEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELGCTQCSDGFLYYLRGG
Ga0181390_103477343300017719SeawaterMIFNDGMERKVRKLLDHTQLTDSEIAEAMGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGI
Ga0181431_100421563300017735SeawaterMKLNDGMQRKMIKLLDHTELTYSEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELGCTQCSEGFLYYLRGGNDDRV
Ga0181553_1013554543300018416Salt MarshMRLSDGMERRMIKLLDHTELNYTEIAEAVGVHRREVEKFVRRRTEGVSLSDEELACTQCSEGFLYYLRGGNDDRV
Ga0181558_1037409623300018417Salt MarshMKLNDGMERKMIKLLDHTELTYSEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELGCTQCSEGFLYYLRGGNDDRV
Ga0181563_1013318643300018420Salt MarshMRLSDGMERKMIKLLDHTELTYSEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELGCTQCSEGFLYYLRGGNDDRV
Ga0206127_103515663300020169SeawaterMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVEKFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV
Ga0206682_1011237923300021185SeawaterMKLSDGMERRMIKLLDHTELTYSEIAEAVGVHRQEVEKFVRRRSEGTSLSDEELACTQCSEGFLYYLRGGNDDRV
Ga0213862_1008154833300021347SeawaterMKLNDGMQRKMIKLLDHTELTYTEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELGCTQCSEGFLYYLRGGNDDRV
Ga0213863_1035928923300021371SeawaterMRLNDGMERKMIKLLDHTELTYTEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELGCTQCSDGFLYYLRGGNDDRV
Ga0212030_103300313300022053AqueousMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACTQTTDGFMSYLGGGRI
Ga0212030_106517413300022053AqueousMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQPTDG
Ga0212022_103081423300022164AqueousMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACTQTTDGFMSYLGGGRID
Ga0196903_100551943300022169AqueousMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGND
Ga0224499_1020736933300022206SedimentMRLSDGMERRMIKLLDHTELTNTEIAEAVGIHRQDVEKFKRRRNELTTLSDEELACTQPTDGFL
Ga0224502_1038116223300022218SedimentMRLNDGMERRMIKLLDHTELTNTEIAEAVGIHRQDVEKFKRRRNELTTLSDEELACTQPTDGFLYYLRGGNDDRV
(restricted) Ga0233411_1000643353300023112SeawaterMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV
(restricted) Ga0233412_1053254923300023210SeawaterMIFNDGMERKVRKLLDHTQLTDSEIAEAMGVHRQDIERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGI
(restricted) Ga0233410_1006600943300023276SeawaterMNFNDGMTRKMIKLLDHTGLNYSEIAEAVGAHRQDVERFVRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV
(restricted) Ga0255039_1002641243300024062SeawaterMRLSDGMERRMIKLLDHTELTNTEIAEAVGIHRQDVEKFKRRRNELTTLSDEELACTQPTDGFLYYLRGGNDDRV
(restricted) Ga0255042_1007858323300024340SeawaterMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQQTDGFLYYLRGGNDDRV
Ga0244776_1067976523300024348EstuarineIMRLSDGMERRMIKLLDHTELTNTEIAEAVGIHRQDVEKFKRRRNELTTLSDEELACTQPTDGFLYYLRGGNDDRV
(restricted) Ga0255048_1044801723300024518SeawaterMERKVRKLLDHTQLTNSEIAEAMGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGI
(restricted) Ga0255046_1007868823300024519SeawaterMIFNDGMERKVRKLLDHTQLTDSEIAEAMGVHRQDIERFKRRRNEPTSLSDEELACTQPTDGFMYYLGGGRID
(restricted) Ga0255047_1010201743300024520SeawaterMIFNDGMERKVRKLLDHTQLTDSEIAEAMGVHRQDIERFKRRRNEPTSLSDEELACTQPTDGFMYYLGG
(restricted) Ga0255044_1025215533300024529SeawaterLLDHTELNYSEIAEAVGAHRQDIERFVRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDG
(restricted) Ga0255044_1040452413300024529SeawaterMNFNDGMTRKMIKLLDHTGLNYSEIAEAVGAHRQDIERFVRRRNEPTSLSDEELACTQPT
Ga0208792_100507673300025085MarineMKLSDGMERRMIKLLDHTELNYTEIAEAVGVHRQEVEKFVRRRTEGTSLSDEELACTQCSEGFLYYLRGGNDDRV
Ga0208434_101550213300025098MarineMKLSDGMERRMIKLLDHTELNYTEIAEAVGVHRQEVDKFVRRRTEGTSLSDEELACTQCSEGFLYYLRGGNDDRV
Ga0208148_100228093300025508AqueousMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPKSLSDEELACTQTTDGFMSYLGGGRID
Ga0209405_1000385113300025620Pelagic MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPISLSDEELACTQPTDGFMLYLGGGRID
Ga0209198_102330453300025640Pelagic MarineMNFNDGMERKVRKLLDHTQLNNSEIAEAVGVHRQDIERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV
Ga0208899_110704913300025759AqueousMKLNDGMQRKMIKLLDHTELTYTEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELGCTQCSEGF
Ga0208309_104603823300027226EstuarineGMERRMIKLLDHTELTNTEIAEAVGIHRQDVEKFKRRRNELTTLSDEELACTQPTDGFLYYLRGGNDDRV
Ga0209383_101924253300027672MarineMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVNRQDIERFKRRRNEPVSLCDEELACTQTTNGFMSYLRGGNDGI
Ga0209092_1007187743300027833MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVEKFKRRRNEPKSLSDEELACTQPTDGFLYYLRGGNDGV
Ga0209092_1008298843300027833MarineMNFNDGMTRKMIKLLDHTELNYSEIAEAVGAHRQDVERFVRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV
Ga0209092_1008607943300027833MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFMLYLGGGRID
Ga0209271_1007534743300027845Marine SedimentMNFNDGMEKKVRKLLDHTGMTNTEIAEAVGVHRQDIERFKRRRNEPKSLSDEELACTQTTDGFMFYLGGGRID
(restricted) Ga0233413_1041517623300027996SeawaterMIFNDGMERKVRKLLDHTQLTDSEIAEAMGVHRQDIERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV
(restricted) Ga0233414_1060490323300028045SeawaterVRKLLDHTQLTDSEIAEAIGVHRQDIERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV
Ga0256368_100256343300028125Sea-Ice BrineMNFNDGMERKVRKLLDHTQLSNSEIAEAIGVHRQDIERFVRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV
Ga0257120_100521253300028284MarineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDDRV
Ga0307488_1008543143300031519Sackhole BrineMNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSEEELACTQPTDGFLYYLRGGNDGV
Ga0307489_1102583413300031569Sackhole BrineLDHTELTNTEIAEAVGVHRQDVERFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV
Ga0315331_1082217723300031774SeawaterMKLNDGMQRKMIKLLDHTELTYTEIAEAVGVHRQEVEKFVRRRTESTSLSEEELGCTQCSDGFLYYLRGGNDDRV
Ga0316191_1015237523300032258Worm BurrowMNFNDGMTRKMIKLLDHTELTNTEIAEAIGVHRQDVEKFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV
Ga0316189_1050314333300032272Worm BurrowMKLSDGMERRMIKLLDHTELNYTEIAEAVGVHRQEVDKFVRRRTEGTSLSEEELACTQCSEGFLYYLRGGNDDRV
Ga0316203_106447743300032274Microbial MatDGMERRMMKLLDHTELNYSEIAEAVGVHRQEVERFVRRRTEGASLSDEELACTQCSEGFLYYLRGGNDDRV
Ga0316202_1005121723300032277Microbial MatMKLSDGMERRMMKLLDHTELNYSEIAEAVGVHRQEVERFVRRRTEGASLSDEELACTQCSEGFLYYLRGGNDDRV
Ga0316202_1013081333300032277Microbial MatMRLSDGMERRMIKLLDHTELNYTEIAEAVGVHRQEVEKFVRRRTEGVSLSDEELACTQCSEGFLYYLRGGNDDRV
Ga0316202_1018709223300032277Microbial MatMKLNDGMERKMIKLLDHTELTYSEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELACTQCSEGFLYYLRGGNDDRV
Ga0316204_1101528023300032373Microbial MatMKLNDGMERKMIKLLDHTELTYSEIAEAVGVHRQEVEKFVRRRTEGTSLSEEELACTQCSEGFLY
Ga0316193_1005837453300033429SedimentMNFNDGMTRKMIKLLDHTELTNTEIAEAIGVHRQDVERFKRRRNEPTSLSDEELACNQPTDGFLYYLRGGNDGV
Ga0314858_046790_346_5703300033742Sea-Ice BrineMNFNDGMERKVRKLLDHTQLSNSEIAEAIGVHRQDIERFVRRRNEPVSLSDEELACTQPTDGFLYYLRGGNDGV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.