Scaffold Ga0129285_10038749

Overview

Basic Information

• Taxon OID: 3300009513
• Scaffold ID: Ga0129285_10038749
• Source Dataset Name: Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1Y
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Delaware
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1866
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater → Microbial Role In Biogeochemical Cycling In A Beach Aquifer System

Source Dataset Sampling Location

• Location Name: Cape Shores, Lewes, Delaware, USA
• Coordinates
  • Lat. (^o): 38.7855
  • Long. (^o): -75.1045

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011939	Metagenome / Metatranscriptome	285	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129285_100387492	F011939	AGAAGG	MPRLTLKLAEETLRKEVQKLDKRTQVVGVAQSKKKDAYRVTLLKDGRTSSADLKKDLLKQCLAQEGKGGGLKKALGKAVSHLSIKYR*