Scaffold Ga0119763_10713963

Overview

Basic Information

• Taxon OID: 3300009487
• Scaffold ID: Ga0119763_10713963
• Source Dataset Name: Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS854 no min length
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 831
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin234 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Marine Hydrothermal Vent → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Mid-Cayman Rise
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003622	Metagenome / Metatranscriptome	476	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119763_107139632	F003622	N/A	MRAYKKELEIIANDILNQNAEAKGNENKPNYSNREFMNALIIFQTALMDKMFDNMDYDNMDLENRNKMATKCGLDLRKLIHTYTGLDTHKVDDFIN*