3300009487: Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS854 no min length

Overview

Basic Information

• IMG/M Taxon OID: 3300009487
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114926 | Gp0118614 | Ga0119763
• Sample Name: Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS854 no min length
• Sequencing Status: Permanent Draft
• Sequencing Center: Marine Biological Laboratory
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 296153474
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin234	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Marine Hydrothermal Vent → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Mid-Cayman Rise
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003622	Metagenome / Metatranscriptome	476	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0119763_10713963	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin234	831

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0119763_10713963	Ga0119763_107139632	F003622	MRAYKKELEIIANDILNQNAEAKGNENKPNYSNREFMNALIIFQTALMDKMFDNMDYDNMDLENRNKMATKCGLDLRKLIHTYTGLDTHKVDDFIN*