| Basic Information | |
|---|---|
| Taxon OID | 3300009479 Open in IMG/M |
| Scaffold ID | Ga0127529_1035863 Open in IMG/M |
| Source Dataset Name | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Texas, Austin |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2754 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Wheat → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Marana, AZ, USA | |||||||
| Coordinates | Lat. (o) | 32.436857 | Long. (o) | -111.228276 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060091 | Metagenome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0127529_10358636 | F060091 | GAG | MMAHELFKLDLSSESDSDEELDELVLYSLIKRKKSRNSDFMKKRKSYREFVLTKELSEKQFTNYFRLNRFQFHEVLHIIKDTIFSEECNAQRPIEPEEKLAVFLR* |
| ⦗Top⦘ |