3300009479: Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov

Overview

Basic Information

• IMG/M Taxon OID: 3300009479
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118459 | Gp0139340 | Ga0127529
• Sample Name: Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Texas, Austin
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 255311039
• Sequencing Scaffolds: 8
• Novel Protein Genes: 8
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini	2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Wheat → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal corpus

Location Information

• Location: Marana, AZ, USA
• Coordinates
  • Lat. (^o): 32.436857
  • Long. (^o): -111.228276
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y
F060091	Metagenome	133	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0127529_1008064	Not Available	2576
Ga0127529_1016164	Not Available	1024
Ga0127529_1020501	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini	2113
Ga0127529_1035863	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	2754
Ga0127529_1050879	Not Available	2096
Ga0127529_1055953	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum	4240
Ga0127529_1065091	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini	1817
Ga0127529_1067652	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis	4661

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0127529_1008064	Ga0127529_10080641	F029983	MSHCCTVGYKWVAIMDGFNFKSNDIISLYNKNDSERKQSV
Ga0127529_1016164	Ga0127529_10161641	F029983	VGXXXSLCCTVGYKEVTVMDGXXXEFDDIISLYKKND
Ga0127529_1020501	Ga0127529_10205011	F029983	MSLCSTVGFKWVTVMDGVKFQFNDIISLYKKNGQSAY
Ga0127529_1035863	Ga0127529_10358636	F060091	MMAHELFKLDLSSESDSDEELDELVLYSLIKRKKSRNSDFMKKRKSYREFVLTKELSEKQFTNYFRLNRFQFHEVLHIIKDTIFSEECNAQRPIEPEEKLAVFLR*
Ga0127529_1050879	Ga0127529_10508791	F029983	MSLCCTVGYKWVTVMDGVKFEFNDIIWLYKKNDSE
Ga0127529_1055953	Ga0127529_10559531	F029983	VSLXXTEVYKWDTVMDGVKXEFNDIILLYEKNNSERKRSV
Ga0127529_1065091	Ga0127529_10650912	F060091	MGEQHDLNYKLDLSSESDSDEEMNELLLLYSLSKRNKSIWKSEYMKKRKSHGEFILTSEFSDKQFTNYFRLNRNQFNEVLSIVNDKIYSVGCNAQKPIDPEEKLAVFLR*
Ga0127529_1067652	Ga0127529_10676522	F029983	MSLCCTVGDKLVTVMDGVKXEFNDIISXXXXXDSERKRTVSL*