Scaffold Ga0114939_10228954

Overview

Basic Information

• Taxon OID: 3300009455
• Scaffold ID: Ga0114939_10228954
• Source Dataset Name: Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 788
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Ash Meadows Crystal Spring, Nevada
• Coordinates
  • Lat. (^o): 36.42
  • Long. (^o): -116.32
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070270	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114939_102289541	F070270	N/A	GLAASFTELGVDLTTAKKFGPIVIDYVAHHGGEDLVDKIKAALKL*