NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114940_10134599

Scaffold Ga0114940_10134599


Overview

Basic Information
Taxon OID3300009448 Open in IMG/M
Scaffold IDGa0114940_10134599 Open in IMG/M
Source Dataset NameGroundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1100
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCold Creek Source, Nevada
CoordinatesLat. (o)36.41Long. (o)-115.74Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094045Metagenome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0114940_101345991F094045N/ALFIWIAVIFMAFTRDNTNEIFALYLAVMTSTVILFLIGFAKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.