| Basic Information | |
|---|---|
| Taxon OID | 3300009419 Open in IMG/M |
| Scaffold ID | Ga0114982_1034319 Open in IMG/M |
| Source Dataset Name | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1639 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ohio, USA | |||||||
| Coordinates | Lat. (o) | 39.849 | Long. (o) | -81.036 | Alt. (m) | Depth (m) | 2500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F093757 | Metagenome / Metatranscriptome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114982_10343194 | F093757 | AGAAG | MTKTNREKNTEHDRKEILRVRPKQEGKYNFEALQTVINQWIRGK* |
| ⦗Top⦘ |