| Basic Information | |
|---|---|
| Family ID | F093757 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKTNKEKNTEHAGRELLRVRPKQPAYDFEPLEAVIRQWITGSK |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 61.32 % |
| % of genes near scaffold ends (potentially truncated) | 11.32 % |
| % of genes from short scaffolds (< 2000 bps) | 62.26 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (54.717 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.038 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.226 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.094 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.62% β-sheet: 0.00% Coil/Unstructured: 63.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00004 | AAA | 3.77 |
| PF06056 | Terminase_5 | 2.83 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.89 |
| PF00583 | Acetyltransf_1 | 0.94 |
| PF01471 | PG_binding_1 | 0.94 |
| PF02979 | NHase_alpha | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.28 % |
| Unclassified | root | N/A | 4.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000736|JGI12547J11936_1022840 | All Organisms → Viruses → Predicted Viral | 1473 | Open in IMG/M |
| 3300000867|EsTDRAFT_1022343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2121 | Open in IMG/M |
| 3300002835|B570J40625_100409872 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300002835|B570J40625_101433958 | Not Available | 569 | Open in IMG/M |
| 3300003277|JGI25908J49247_10000832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9591 | Open in IMG/M |
| 3300003277|JGI25908J49247_10035974 | All Organisms → Viruses → Predicted Viral | 1368 | Open in IMG/M |
| 3300003413|JGI25922J50271_10012044 | All Organisms → Viruses → Predicted Viral | 2309 | Open in IMG/M |
| 3300003787|Ga0007811_1003389 | All Organisms → Viruses → Predicted Viral | 1953 | Open in IMG/M |
| 3300004112|Ga0065166_10294774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300004128|Ga0066180_10229430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300004686|Ga0065173_1098767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300004792|Ga0007761_11373461 | All Organisms → Viruses → Predicted Viral | 2073 | Open in IMG/M |
| 3300005582|Ga0049080_10168773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300005582|Ga0049080_10200104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300005584|Ga0049082_10212713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300005584|Ga0049082_10331223 | Not Available | 505 | Open in IMG/M |
| 3300005662|Ga0078894_10060130 | All Organisms → Viruses → Predicted Viral | 3250 | Open in IMG/M |
| 3300005662|Ga0078894_10114242 | All Organisms → Viruses → Predicted Viral | 2397 | Open in IMG/M |
| 3300005662|Ga0078894_10251426 | All Organisms → Viruses → Predicted Viral | 1603 | Open in IMG/M |
| 3300005662|Ga0078894_10499205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
| 3300005662|Ga0078894_10666893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300005662|Ga0078894_11310644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300005662|Ga0078894_11454072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300005758|Ga0078117_1014674 | All Organisms → Viruses → Predicted Viral | 3260 | Open in IMG/M |
| 3300005941|Ga0070743_10171006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300006641|Ga0075471_10176751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1120 | Open in IMG/M |
| 3300006917|Ga0075472_10242112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
| 3300007559|Ga0102828_1106393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300007708|Ga0102859_1270212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300008055|Ga0108970_10063544 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300008107|Ga0114340_1022465 | All Organisms → Viruses → Predicted Viral | 2959 | Open in IMG/M |
| 3300008119|Ga0114354_1008516 | All Organisms → Viruses → Predicted Viral | 4798 | Open in IMG/M |
| 3300009024|Ga0102811_1314527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300009159|Ga0114978_10406072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300009164|Ga0114975_10044807 | All Organisms → Viruses → Predicted Viral | 2618 | Open in IMG/M |
| 3300009419|Ga0114982_1000122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37779 | Open in IMG/M |
| 3300009419|Ga0114982_1000785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16662 | Open in IMG/M |
| 3300009419|Ga0114982_1009702 | All Organisms → Viruses → Predicted Viral | 3438 | Open in IMG/M |
| 3300009419|Ga0114982_1034319 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
| 3300009419|Ga0114982_1035002 | All Organisms → Viruses → Predicted Viral | 1620 | Open in IMG/M |
| 3300010354|Ga0129333_10010866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8614 | Open in IMG/M |
| 3300010354|Ga0129333_10856137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300010374|Ga0114986_1067005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300010388|Ga0136551_1005311 | All Organisms → Viruses → Predicted Viral | 2901 | Open in IMG/M |
| 3300010970|Ga0137575_10009104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1741 | Open in IMG/M |
| 3300012012|Ga0153799_1096515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300012346|Ga0157141_1000923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7393 | Open in IMG/M |
| 3300012346|Ga0157141_1003097 | All Organisms → Viruses → Predicted Viral | 3032 | Open in IMG/M |
| 3300012663|Ga0157203_1009622 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
| 3300012664|Ga0157497_1013858 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300012665|Ga0157210_1000190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30350 | Open in IMG/M |
| 3300012665|Ga0157210_1001719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6384 | Open in IMG/M |
| 3300012665|Ga0157210_1002574 | All Organisms → Viruses → Predicted Viral | 4603 | Open in IMG/M |
| 3300012665|Ga0157210_1003005 | All Organisms → Viruses → Predicted Viral | 4050 | Open in IMG/M |
| 3300012665|Ga0157210_1005219 | All Organisms → Viruses → Predicted Viral | 2665 | Open in IMG/M |
| 3300012763|Ga0138289_1122584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300013295|Ga0170791_11031214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300020141|Ga0211732_1258447 | All Organisms → Viruses → Predicted Viral | 2915 | Open in IMG/M |
| 3300020141|Ga0211732_1401911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300020141|Ga0211732_1442755 | Not Available | 917 | Open in IMG/M |
| 3300020141|Ga0211732_1521713 | All Organisms → Viruses → Predicted Viral | 1877 | Open in IMG/M |
| 3300020160|Ga0211733_10199153 | All Organisms → Viruses → Predicted Viral | 1201 | Open in IMG/M |
| 3300020161|Ga0211726_10136793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300020162|Ga0211735_10132178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300020162|Ga0211735_10601162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300020162|Ga0211735_11034728 | All Organisms → Viruses → Predicted Viral | 1449 | Open in IMG/M |
| 3300020205|Ga0211731_10126991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300020205|Ga0211731_10240411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1365 | Open in IMG/M |
| 3300021336|Ga0210307_1027009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300021519|Ga0194048_10042168 | All Organisms → Viruses → Predicted Viral | 1872 | Open in IMG/M |
| 3300021952|Ga0213921_1021465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
| 3300021956|Ga0213922_1005783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3729 | Open in IMG/M |
| 3300021963|Ga0222712_10040912 | All Organisms → Viruses → Predicted Viral | 3545 | Open in IMG/M |
| 3300021963|Ga0222712_10646227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300021963|Ga0222712_10684042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300024346|Ga0244775_10285395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
| 3300024346|Ga0244775_11340533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300024348|Ga0244776_10896590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300025369|Ga0208382_1007391 | All Organisms → Viruses → Predicted Viral | 1932 | Open in IMG/M |
| 3300025379|Ga0208738_1008244 | All Organisms → Viruses → Predicted Viral | 1849 | Open in IMG/M |
| 3300025396|Ga0208874_1005623 | All Organisms → Viruses → Predicted Viral | 2551 | Open in IMG/M |
| 3300025398|Ga0208251_1008296 | All Organisms → Viruses → Predicted Viral | 2143 | Open in IMG/M |
| 3300025848|Ga0208005_1100333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
| 3300027143|Ga0255105_1000983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7615 | Open in IMG/M |
| 3300027563|Ga0209552_1000362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14558 | Open in IMG/M |
| 3300027563|Ga0209552_1040241 | All Organisms → Viruses → Predicted Viral | 1349 | Open in IMG/M |
| 3300027571|Ga0208897_1091096 | Not Available | 781 | Open in IMG/M |
| 3300027586|Ga0208966_1190080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300027600|Ga0255117_1001010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8669 | Open in IMG/M |
| 3300027710|Ga0209599_10000255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37722 | Open in IMG/M |
| 3300027710|Ga0209599_10000805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17735 | Open in IMG/M |
| 3300027710|Ga0209599_10005192 | All Organisms → Viruses → Predicted Viral | 4574 | Open in IMG/M |
| 3300027710|Ga0209599_10014739 | All Organisms → Viruses → Predicted Viral | 2291 | Open in IMG/M |
| 3300027710|Ga0209599_10025416 | All Organisms → Viruses → Predicted Viral | 1640 | Open in IMG/M |
| 3300027720|Ga0209617_10032856 | All Organisms → Viruses → Predicted Viral | 2237 | Open in IMG/M |
| 3300027759|Ga0209296_1023986 | All Organisms → Viruses → Predicted Viral | 3438 | Open in IMG/M |
| 3300027764|Ga0209134_10037318 | All Organisms → Viruses → Predicted Viral | 1589 | Open in IMG/M |
| 3300027772|Ga0209768_10239908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
| 3300027969|Ga0209191_1005820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6919 | Open in IMG/M |
| 3300029930|Ga0119944_1019574 | Not Available | 929 | Open in IMG/M |
| 3300029933|Ga0119945_1003011 | All Organisms → Viruses → Predicted Viral | 2441 | Open in IMG/M |
| 3300031784|Ga0315899_11327494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300032092|Ga0315905_10069085 | All Organisms → Viruses → Predicted Viral | 3578 | Open in IMG/M |
| 3300032093|Ga0315902_10983025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300033992|Ga0334992_0217138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
| 3300034013|Ga0334991_0007586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7369 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.26% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 10.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 8.49% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 5.66% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.72% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.72% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.83% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.83% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.89% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.89% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.89% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.89% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.89% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.89% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.94% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.94% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine | 0.94% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300000867 | Estuary microbial communities from the Columbia River - metatranscriptome 5 PSU | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012664 | Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021336 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027143 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12547J11936_10228405 | 3300000736 | Freshwater And Sediment | MKTNREKNTEHERKELMRVRPKQAATYDFAPLEAVIRKWITGNK* |
| EsTDRAFT_10223437 | 3300000867 | Freshwater And Marine | MKTNKELNKEHAGRELLRVRPKQAVYDFKALEAVIRQWITGTK* |
| B570J40625_1004098722 | 3300002835 | Freshwater | MKTNRQLNKDHAGRELLKVRPKQPAWDFKSLEAVIRQWITQAK* |
| B570J40625_1014339582 | 3300002835 | Freshwater | MKTNREKNTAHARKELERVRPKQPDYDWASLEAVIRKWVQG* |
| JGI25908J49247_1000083211 | 3300003277 | Freshwater Lake | MKTNREKNTEHDRKEILRVRPKQPAYNFKELEAIVRQWVVNGK* |
| JGI25908J49247_100359746 | 3300003277 | Freshwater Lake | MKTNKEKNKEHAGRELLRVRPKQFVYDFKALEAVIRQWVTKNEQT* |
| JGI25922J50271_100120442 | 3300003413 | Freshwater Lake | MKTNREKNTEHDRKEILRVRPKQPEYNWKELEAIVRQWVVNGK* |
| Ga0007811_10033895 | 3300003787 | Freshwater | MKSNKEKNLAHDAREQARVRPKQPAYEFEALEAVIRQWVKGNE* |
| Ga0065166_102947743 | 3300004112 | Freshwater Lake | MKTNKEKNKEHAGRELLRVRPKQAAYNFEPLEAVIRQWIIGNK* |
| Ga0066180_102294302 | 3300004128 | Freshwater Lake | MKTNKEKNTEHAGRELLRVRPKQSPYDFAPLEAVIRKWITGNK* |
| Ga0065173_10987672 | 3300004686 | Freshwater | MKTNKQLNTEHDAREQARVRPKQPAYEFEALEAVIRQWVKGNE* |
| Ga0007761_113734612 | 3300004792 | Freshwater Lake | MKTNKEKNIEHERKELMRVRPKQAATYDFAPLEAVIRKWITGSK* |
| Ga0049080_101687732 | 3300005582 | Freshwater Lentic | MKTNKELNKDHAGRELLRVRPKQPMYDFQALQAVIRQWITGTK* |
| Ga0049080_102001043 | 3300005582 | Freshwater Lentic | MKTNREKNTEHERKELMRVRPKQAATYDFAPLEAGIRKWITGNK* |
| Ga0049082_102127132 | 3300005584 | Freshwater Lentic | MKTNRQLNKDHAGRELLKVRPKQPAWDFKSLEAVIRQWVAQAK* |
| Ga0049082_103312231 | 3300005584 | Freshwater Lentic | MKTNKELNKDHVGRELLRVRPKQPDWDFKSLEAVIRQWVTGNK* |
| Ga0078894_100601305 | 3300005662 | Freshwater Lake | MKTNKDKNKQHEQDQLMRVRPKQPAYDFAPLEAVIRQWVTESK* |
| Ga0078894_101142427 | 3300005662 | Freshwater Lake | MKTNRQLNKDHAGRELLRVRPKTPAYDFAPLEAVIRQWVTGTK* |
| Ga0078894_102514263 | 3300005662 | Freshwater Lake | MSKTNKEKNQEHDSRQVIRPKQPAYDFAGLEAVIRQWVKGRE* |
| Ga0078894_104992053 | 3300005662 | Freshwater Lake | MTKTNREKNKEHDGRELLRVRPKQSAYEFKALEDVIRQWVTSTK* |
| Ga0078894_106668932 | 3300005662 | Freshwater Lake | MKTNKELNKEHAGRELLRVRPKQPAYDFKPLEDVIRQWITGAK* |
| Ga0078894_113106442 | 3300005662 | Freshwater Lake | MKTNKEKNKEHDGRELLRVRPKQPAYDFKTLEDVIRQWVVGNK* |
| Ga0078894_114540722 | 3300005662 | Freshwater Lake | MKTNKEKNTEHAGRELLRVRPKQPAYDFEPLEAVIRQWITESK* |
| Ga0078117_101467411 | 3300005758 | Lake Water | MKTNREKNTAHARKELERVRPKQPSYDWASLEAVIRKWVQG* |
| Ga0070743_101710061 | 3300005941 | Estuarine | MKTNKEKNKEHAGRELLRVRPKQAVYDFETLGAVIRQWITGTK* |
| Ga0075471_101767513 | 3300006641 | Aqueous | MKKTNRELNKEHAGKELLRVRPKQPAFDYKPLEAVIRQWVTGVK* |
| Ga0075472_102421123 | 3300006917 | Aqueous | MKTNKEKNQEHANRELMRVRPKGAVYDFAPLEAVIRQWVTGSK* |
| Ga0102828_11063932 | 3300007559 | Estuarine | MKTNKEKNTEHAGRELLRVRPKQPAYEFEPLEAVIRQWITGTK* |
| Ga0102859_12702121 | 3300007708 | Estuarine | MKTNKEKNKEHAGRELLRVRPKQFVYDFKALEAVIRQW |
| Ga0108970_100635443 | 3300008055 | Estuary | MKTNRELNKEHASRELQKVRPKTPDYDFAPLEAVIRQWVMGAK* |
| Ga0114340_10224652 | 3300008107 | Freshwater, Plankton | MKTNRELNKEHSGRELLKVRPKQPAWDFKSLEAVIRQWILQAK* |
| Ga0114354_10085167 | 3300008119 | Freshwater, Plankton | MKTNREKNKEHDGRELLRVRPKQPAYDFKALEDVIRQWVAGNK* |
| Ga0102811_13145272 | 3300009024 | Estuarine | MKTNKEKNKEHAGRELLRVRPKQAVYDFKALEAVIRQWITGTK* |
| Ga0114978_104060722 | 3300009159 | Freshwater Lake | MTKTNREKNTEHDKKELLRVRPKQPNYQWKELEAIVRLWAVKGHE* |
| Ga0114975_100448079 | 3300009164 | Freshwater Lake | MKTNKELNKDHAGRELLRVRPKQPAYDFKALEAVIRQWITGTK* |
| Ga0114982_100012266 | 3300009419 | Deep Subsurface | MKTNREKNTEHDKKEILRVRPKQEGKYEFEPLAAVIRQWVTANEQT* |
| Ga0114982_100078527 | 3300009419 | Deep Subsurface | MKTNRDKNKEHDSREILRVRPKQAPYEFKALEDVIRSWVTGNK* |
| Ga0114982_10097023 | 3300009419 | Deep Subsurface | MKTNKEKNTEHAGRELLRVRPKQPAYEFEPLEAVIRQWITGSK* |
| Ga0114982_10343194 | 3300009419 | Deep Subsurface | MTKTNREKNTEHDRKEILRVRPKQEGKYNFEALQTVINQWIRGK* |
| Ga0114982_10350025 | 3300009419 | Deep Subsurface | MNKTNKELNKEHAGKELLRVRPKSPSYDFAPLAAVIRLWVTGK* |
| Ga0129333_1001086619 | 3300010354 | Freshwater To Marine Saline Gradient | MKTNKEKNQEHERKELMRVRPKQPAYNFKPLEEVVRKWVQSK* |
| Ga0129333_108561372 | 3300010354 | Freshwater To Marine Saline Gradient | MKTNKEKNQEHERKELMRVRPKQPAYDFKPLEEVVRKWAQNK* |
| Ga0114986_10670052 | 3300010374 | Deep Subsurface | MNKTNREKNTEHDRKEILRVRPKMEGKYNFEALQTVINQWIRGK* |
| Ga0136551_10053118 | 3300010388 | Pond Fresh Water | MKTNRELNTEHDRKEILRVRPKQAKYDFAPLDAVIRQWVKGNEQT* |
| Ga0137575_100091042 | 3300010970 | Pond Fresh Water | MKSNREKNTEHDRKEILRVRPKQAGKYEFEALEAVIRQWITEAE* |
| Ga0153799_10965152 | 3300012012 | Freshwater | MKTNKELNKDHAGRELLRVRPKQPVYDFQALQAVIRQWILGTK* |
| Ga0157141_100092318 | 3300012346 | Freshwater | MKTNREKNTEHDRKEILRVRPKQAGKYDFAPLEAVVRQWVTEAK* |
| Ga0157141_10030976 | 3300012346 | Freshwater | MKSNKELNTAHAGKELLRVRPKGPVYDFAPLEAVIRLWATSK* |
| Ga0157203_10096224 | 3300012663 | Freshwater | MKTNKEKNTEHAGRELLRVRPKQAAYVFEPLEAVIRQWIIGNK* |
| Ga0157497_10138585 | 3300012664 | Freshwater | LNTEHDRKEILRVRPKQAKYDFAPLEAVIRQWVKGNEQT* |
| Ga0157210_100019062 | 3300012665 | Freshwater | MKTNRDKNKEHDSREILRVRPKQAAYDFKPLESVIRQWITSSK* |
| Ga0157210_100171914 | 3300012665 | Freshwater | MKTNREKNTEHDRKEILRVRPKQPAYNFKELEAIVRQWVVNSK* |
| Ga0157210_10025747 | 3300012665 | Freshwater | MKTNKELNKDHVGRELLRVRPKQPAYDFKALEAVIRQWIIGTK* |
| Ga0157210_10030056 | 3300012665 | Freshwater | MKTNKQKNTEHEGRELLRVRPKQPAYDFEPLEAVIRQWITESK* |
| Ga0157210_10052196 | 3300012665 | Freshwater | MKTNKEKNTEHAGRELLRVRPKQPAYDFEPLEAVIRQWITGSK* |
| Ga0138289_11225841 | 3300012763 | Freshwater Lake | LNKDHAGRELLKVRPKQPAWDFKSLEAVIRQWITQAK* |
| Ga0170791_110312143 | 3300013295 | Freshwater | LNKDHAGRELLRVRPKQPAYDFKALEAVIRQWITGTK* |
| Ga0211732_12584472 | 3300020141 | Freshwater | MKTNKEKNKEHEGRELLRVRPKQFVYDFKALEAVIRQWVTKNEQT |
| Ga0211732_14019111 | 3300020141 | Freshwater | MKTNKEKNTEHAGRELLRVRPKQAAYVFEPLEAVIRQWIIGNK |
| Ga0211732_14427553 | 3300020141 | Freshwater | MKTNRQLNKDHAGRELLKVRPKQPAWDFKSLEAVIRQWITQSK |
| Ga0211732_15217133 | 3300020141 | Freshwater | MKTNKEKNKEHAGRELLRVRPKQAAYNFEPLEAVIRQWIIGNK |
| Ga0211733_101991532 | 3300020160 | Freshwater | MKTNKEKNTEHAGRELLRVRPKQPAYDFESLEAVIRQWITGTK |
| Ga0211726_101367931 | 3300020161 | Freshwater | MKTIRQLNKDHAGRELLKVRPKQVVWDFKSLEAVIRQWITQSK |
| Ga0211735_101321782 | 3300020162 | Freshwater | MKTNKEKNTEHAGRELLRVRPKQAAYVFEPLEAVIRQWITGTK |
| Ga0211735_106011622 | 3300020162 | Freshwater | MKTNKEKNKEHAGRELLRVRPKQAAYNFEPLEAVIR |
| Ga0211735_110347281 | 3300020162 | Freshwater | TNKQLNKDHAGRELLRVRPKQPAYDFGPLEAVIRQWIIGTK |
| Ga0211731_101269911 | 3300020205 | Freshwater | MKTNKEKNTEHAGRELLRVRPKQPAYNFEPLEAVIRQWIIGNK |
| Ga0211731_102404115 | 3300020205 | Freshwater | NTEHAGRELLRVRPKQPAYDFESLEAVIRQWITGTK |
| Ga0210307_10270091 | 3300021336 | Estuarine | MKTNKEKNKEHAGRELLRVRPKQFVYDFKALEAVIRQWVTKN |
| Ga0194048_100421682 | 3300021519 | Anoxic Zone Freshwater | MKTNREKNTEHDRKELMRVRPKQAGKYEYEALEAVIRQWITESK |
| Ga0213921_10214652 | 3300021952 | Freshwater | MNKTNREKNTEHDRKEILRVRPKQAGNYEFTALQEVVRKWVLSK |
| Ga0213922_100578311 | 3300021956 | Freshwater | MKTNKEKNIEHDRKELLRVRPKQAAYDFKPLEAVIRQWVTGVQ |
| Ga0222712_100409127 | 3300021963 | Estuarine Water | MKTNREKNKEHDGREILRVRPKQAAYEFKALEDVIRQWVTGSK |
| Ga0222712_106462271 | 3300021963 | Estuarine Water | MKTNREKNKEHDGRELLRVRPKQPAYDFKALEDVI |
| Ga0222712_106840422 | 3300021963 | Estuarine Water | MNKTNKELNQAHAQREQERVRPKQAAYEFEALEAVIRQWITGAK |
| Ga0244775_102853952 | 3300024346 | Estuarine | MKTNKEKNTEHAGRELLRVRPKQPAYNFEPLEAVIRQWIIGSK |
| Ga0244775_113405332 | 3300024346 | Estuarine | MKTNKEKNKEHAGRELLRVRPKQAVYDFETLGAVIRQWITGTK |
| Ga0244776_108965901 | 3300024348 | Estuarine | MKTNKEKNKEHAGRELLRVRPKQFVYDFKALEAVIRQWVTKNEQT |
| Ga0208382_10073912 | 3300025369 | Freshwater | MKTNKQLNTEHDAREQARVRPKQPAYEFEALEAVIRQWVKGNE |
| Ga0208738_10082442 | 3300025379 | Freshwater | MKSNKEKNLAHDAREQAKVRPKQPAYEFEALEAVIRQWVKGNE |
| Ga0208874_10056237 | 3300025396 | Freshwater | MKTNKQLNTEHDAREQARVRPKQPAYEFEALEAVIRQWVKDNE |
| Ga0208251_10082967 | 3300025398 | Freshwater | MKTNKQLNTEHDAREQARVRPKQPAYEFEALEAVIRQWVKGN |
| Ga0208005_11003332 | 3300025848 | Aqueous | MKTNKEKNQEHANRELMRVRPKGAVYDFAPLEAVIRQWVTGSK |
| Ga0255105_10009836 | 3300027143 | Freshwater | MKTNKELNKDHAGRELLRVRPKQPMYDFQALQAVIRQWITGTK |
| Ga0209552_100036220 | 3300027563 | Freshwater Lake | MKTNKEKNIEHERKELMRVRPKQAATYDFAPLEAVIRKWITGSK |
| Ga0209552_10402412 | 3300027563 | Freshwater Lake | MKTNKEKNKEHAGRELLRVRPKQSPYDFALLEAVIRKWITGNK |
| Ga0208897_10910963 | 3300027571 | Estuarine | MKTNKEKNKEHAGRELLRVRPKQAVYDFETLGAVIRQWIIGSK |
| Ga0208966_11900802 | 3300027586 | Freshwater Lentic | MKTNRQLNKDHAGRELLKVRPKQPAWDFKSLEAVIRQWVAQAK |
| Ga0255117_100101020 | 3300027600 | Freshwater | MKTNKELNKDHAGRELLRVRPKQPVYDFQALQAVIRQWILGTK |
| Ga0209599_1000025566 | 3300027710 | Deep Subsurface | MKTNREKNTEHDKKEILRVRPKQEGKYEFEPLAAVIRQWVTANEQT |
| Ga0209599_1000080522 | 3300027710 | Deep Subsurface | MKTNRDKNKEHDSREILRVRPKQAPYEFKALEDVIRSWVTGNK |
| Ga0209599_100051923 | 3300027710 | Deep Subsurface | MKTNKEKNTEHAGRELLRVRPKQPAYEFEPLEAVIRQWITGSK |
| Ga0209599_100147395 | 3300027710 | Deep Subsurface | MTKTNREKNTEHDRKEILRVRPKQEGKYNFEALQTVINQWIRGK |
| Ga0209599_100254165 | 3300027710 | Deep Subsurface | MNKTNKELNKEHAGKELLRVRPKSPSYDFAPLAAVIRLWVTGK |
| Ga0209617_100328563 | 3300027720 | Freshwater And Sediment | MKTNKEKNTEHERKELMRVRPKQAATYDFAPLEAVIRKWITGNK |
| Ga0209296_102398611 | 3300027759 | Freshwater Lake | MTKTNREKNTEHDKKELLRVRPKQPNYQWKELEAIVRLWAVKGHE |
| Ga0209134_100373187 | 3300027764 | Freshwater Lake | MKTNREKNTEHDRKEILRVRPKQPEYNWKELEAIVRQWVVNGK |
| Ga0209768_102399083 | 3300027772 | Freshwater Lake | MKTNKEKNKEHAGRELLRVRPKQAEYDFKALEAVIRQWILGTK |
| Ga0209191_10058203 | 3300027969 | Freshwater Lake | MKTNKELNKDHAGRELLRVRPKQPAYDFKALEAVIRQWITGTK |
| Ga0119944_10195743 | 3300029930 | Aquatic | NREKNTAHARKELERVRPKQPDYDWASLEAVIRKWVQG |
| Ga0119945_10030117 | 3300029933 | Aquatic | MKTNREKNTAHARKELERVRPKQPDYDWASLEAVIRKWVQG |
| Ga0315899_113274942 | 3300031784 | Freshwater | MKTNRELNKEHSGRELLKVRPKQPAWDFKSLEAVIRQWILQAK |
| Ga0315905_100690856 | 3300032092 | Freshwater | MKTNREKNKEHDGRELLRVRPKQPAYDFKALEDVIRQWVAGNK |
| Ga0315902_109830252 | 3300032093 | Freshwater | MKTNRELNKEHSGRELLKVRPKQPAWDFKSLEAVIRQW |
| Ga0334992_0217138_375_506 | 3300033992 | Freshwater | MKTNRQLNKDHAGRELLKVRPKQPAWDFKSLEAVIRQWITQAK |
| Ga0334991_0007586_2978_3109 | 3300034013 | Freshwater | MKTNKEKNTEHAGRELLRVRPKQAEYDFKALEAVIRQWIIGTK |
| ⦗Top⦘ |