NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0117756_1095115

Scaffold Ga0117756_1095115


Overview

Basic Information
Taxon OID3300009408 Open in IMG/M
Scaffold IDGa0117756_1095115 Open in IMG/M
Source Dataset NameMarine microbial mats from Loihi Seamount, Hawaii, USA. Combined Assembly of Gp0139187, Gp0139188, Gp0139189, Gp0139190, Gp0139191, Gp0139192
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon Health and Science University (OHSU), Western Washington University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)673
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa

Source Dataset Sampling Location
Location NameLoihi Seamount, Hawaii, USA
CoordinatesLat. (o)18.903Long. (o)-155.257Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004905Metagenome / Metatranscriptome419Y

Sequences

Protein IDFamilyRBSSequence
Ga0117756_10951151F004905N/AMRRKVNFQQSEYIQDGEVVCFGVSEHFFEESKHKWSEKAQKDLNVLQSWFSRDKFDEVATRPVYRSDFNWTSYHTRAQLRVLLGLAFIRELPIRNFYIRCWIAYSYIVFFVIRGIGRGMTVARPIVMYNNGIHAKTLANYPDLFWWNIGRRLPKATPVPDVHREWQTRQTPVFHQYHKTAYRYRNRKPRYVPWDGTTSQPVMPYLHDD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.