Scaffold Ga0117756_1066413

Overview

Basic Information

• Taxon OID: 3300009408
• Scaffold ID: Ga0117756_1066413
• Source Dataset Name: Marine microbial mats from Loihi Seamount, Hawaii, USA. Combined Assembly of Gp0139187, Gp0139188, Gp0139189, Gp0139190, Gp0139191, Gp0139192
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon Health and Science University (OHSU), Western Washington University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 926
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa

Source Dataset Sampling Location

• Location Name: Loihi Seamount, Hawaii, USA
• Coordinates
  • Lat. (^o): 18.903
  • Long. (^o): -155.257

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064876	Metagenome / Metatranscriptome	128	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117756_10664131	F064876	GAGG	MATYTDRVEKSVTHYEPGPLPSDPESLGVYTVDELKRLGNVLFNQATFRLERTNVVPDKPRPGDIRYFDGTNADPVGNGIEGLYVYKKGSHWVNVLALDEGTVEITGASGDLALEIDNNVANSANLKIRCDAGSLRSDFYVDNEVHITLKGQRVGILDTSPTYTLDVFGYGRFVQQLTVDDGIACADTVVSRPRFTDYAE