Scaffold Ga0103753_1003661

Overview

Basic Information

• Taxon OID: 3300009394
• Scaffold ID: Ga0103753_1003661
• Source Dataset Name: Microbial communities of red sea marine sponge, Stylissa carteri from the coast of Thuwal, Saudi Arabia - rep 3
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wuerzburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2108
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Red Sea Marine Sponge, Stylissa Carteri From The Coast Of Thuwal, Saudi Arabia

Source Dataset Sampling Location

• Location Name: coast of Thuwal, Saudi Arabia
• Coordinates
  • Lat. (^o): 22.23
  • Long. (^o): 39.03

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007683	Metagenome / Metatranscriptome	346	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103753_10036611	F007683	N/A	MSLGLRFCVSGKGRIGGGANSMAASGLVLRSDLVGTGRAISIYFGINGVRNKRSHLVGPP