Basic Information | |
---|---|
Taxon OID | 3300009388 Open in IMG/M |
Scaffold ID | Ga0103809_1003009 Open in IMG/M |
Source Dataset Name | Metatranscriptome sequencing of an Anaerobic Hexadecane-Degrading Microbial Consortia from University of California, San Diego, USA - Hexadecane |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of California, San Diego |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3698 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Metatranscriptome Sequencing Of An Anaerobic Hexadecane-degrading Microbial Consortia From University Of California, San Diego, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | UCSD, USA | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058725 | Metagenome / Metatranscriptome | 134 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103809_10030093 | F058725 | GGTGG | MGERLKAPFFACVGGGGVLTFVGTADDQAVYWFLEAIDPRPGEGPWPPVGRLQRPRYRVSPIRFGTGFYYGIRIPYGGTVRWHSVNEVNSGLTLTDASKHATNIYLAPKRPPLIRYGMHYKFGQVKYGEGSGLYDRVTVKAVLD* |
⦗Top⦘ |