| Basic Information | |
|---|---|
| Taxon OID | 3300009388 Open in IMG/M |
| Scaffold ID | Ga0103809_1001406 Open in IMG/M |
| Source Dataset Name | Metatranscriptome sequencing of an Anaerobic Hexadecane-Degrading Microbial Consortia from University of California, San Diego, USA - Hexadecane |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, San Diego |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6967 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (72.73%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Metatranscriptome Sequencing Of An Anaerobic Hexadecane-degrading Microbial Consortia From University Of California, San Diego, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | UCSD, USA | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073228 | Metagenome / Metatranscriptome | 120 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103809_10014064 | F073228 | GGA | VEGIDMAITIGDIMDINSSKYGEFLYKIVMVFPHNMEVDKTELARLIKISNNTLTFERKTGEKFTLDERDIEHMDLFKSPNYRGGE* |
| ⦗Top⦘ |