Scaffold Ga0103788_1002506

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103788_1002506

Scaffold Ga0103788_1002506

Overview

Basic Information
Taxon OID	3300009355 Open in IMG/M
Scaffold ID	Ga0103788_1002506 Open in IMG/M
Source Dataset Name	Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone3_total_RNA
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Florida
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	978
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas

Source Dataset Sampling Location
Location Name	Highborne Cay, Bahamas
Coordinates	Lat. (^o)	24.72	Long. (^o)	-76.82	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037503	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103788_10025062	F037503	N/A	MPLGAASDLSLAEVELLIGLEGFTAYQPLTNSECCKIYPGVSAWVLRSVREREITQTIS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.