NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103787_1008969

Scaffold Ga0103787_1008969


Overview

Basic Information
Taxon OID3300009349 Open in IMG/M
Scaffold IDGa0103787_1008969 Open in IMG/M
Source Dataset NameMicrobial communities of thrombolites from Highborne Cay, Bahamas - Zone2_mRNA
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Florida
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)687
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas

Source Dataset Sampling Location
Location NameHighborne Cay, Bahamas
CoordinatesLat. (o)24.72Long. (o)-76.82Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060086Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0103787_10089691F060086N/AILLLSIGQHGEDRKRQYFMYNHETPLLADLIDLLY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.