Basic Information | |
---|---|
Taxon OID | 3300009335 Open in IMG/M |
Scaffold ID | Ga0117926_1038904 Open in IMG/M |
Source Dataset Name | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 198m, 2.7-0.2um, replicate a |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Georgia Genomics Facility |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2143 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Cariaco Basin, Venezuela | |||||||
Coordinates | Lat. (o) | 10.5 | Long. (o) | -64.66 | Alt. (m) | Depth (m) | 198 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081438 | Metagenome / Metatranscriptome | 114 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117926_10389042 | F081438 | GAGG | MNKWIIALIAAGIVLFIAAMVIGVDALMCTPPCV* |
⦗Top⦘ |