| Basic Information | |
|---|---|
| Taxon OID | 3300009285 Open in IMG/M |
| Scaffold ID | Ga0103680_10015184 Open in IMG/M |
| Source Dataset Name | Microbial communities from groundwater in Rifle, Colorado, USA - 2A_0.1um |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Lawrence Berkeley National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5324 |
| Total Scaffold Genes | 16 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (68.75%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater → Microbial Communities From Groundwater In Rifle, Colorado, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rifle, CO, USA | |||||||
| Coordinates | Lat. (o) | 39.32 | Long. (o) | -107.46 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061881 | Metagenome / Metatranscriptome | 131 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103680_100151846 | F061881 | AGGAG | MSLSRDSRQERKLKALRRAQFRLTQRFEYIDWEEDVLIPEVEALKAGRPVFGLTDGRMFEIEIEESHADPDQTPPDHTEPDPRTR* |
| ⦗Top⦘ |