| Basic Information | |
|---|---|
| Taxon OID | 3300009206 Open in IMG/M |
| Scaffold ID | Ga0103750_1033361 Open in IMG/M |
| Source Dataset Name | Microbial communities of wastewater sludge from Singapore - Sludge11_b2_February |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 608 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge → Microbial Communities Of Wastewater Sludge From Singapore |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.2 | Long. (o) | 103.45 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051952 | Metatranscriptome | 143 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103750_10333611 | F051952 | GGAG | MPKNPRQTIAPDHFTSTALSESSWRILGKVTENEVTLVRYFLSKIVYTDEVVTLEETCILFLSFEKMVQKMSQHEAYRAKYGSEVFTFRAVLTSLEDVVSANPQDRLIRMREVYGFYRGKLFSRRYYFSVRGQLTRELRLRVLTRFPKKFKPKAFVGKGYGDHGTAKEMAYDGSPSWQEVAMADTN |
| ⦗Top⦘ |