Basic Information | |
---|---|
Taxon OID | 3300009196 Open in IMG/M |
Scaffold ID | Ga0103745_10023708 Open in IMG/M |
Source Dataset Name | Microbial communities of wastewater sludge from Singapore - Sludge1_b2_February |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 837 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. LPFa | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge → Microbial Communities Of Wastewater Sludge From Singapore |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.2 | Long. (o) | 103.45 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069722 | Metagenome / Metatranscriptome | 123 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103745_100237082 | F069722 | AGG | MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAALQK* |
⦗Top⦘ |