NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114970_10157711

Scaffold Ga0114970_10157711


Overview

Basic Information
Taxon OID3300009163 Open in IMG/M
Scaffold IDGa0114970_10157711 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1360
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023346Metagenome / Metatranscriptome210Y
F045085Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0114970_101577111F023346N/AMKHTPTIVSKNIIITYAQKIRNVQSEQIDPYIELIEQELIKIYPELKDREDNALNWAYDIINETSNNDVVETLNRLDLIVTNERKAQWICDHCGKNTYNDDCEYLFGKNHIGCVLSEDIKNREHSDPDYILDSNLRKFTELEAELRHTKRQLVNLELKLEHLRGDYPHEPTN*
Ga0114970_101577112F045085N/AMNNLYKVIDLTVGLVFGSIFAIGLLIVLTIFFVVLVPFIFYFTLKEVLKALTKTK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.