Scaffold Ga0118735_10002438

Overview

Basic Information

• Taxon OID: 3300009136
• Scaffold ID: Ga0118735_10002438
• Source Dataset Name: Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6481
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location

• Location Name: Hudson Canyon, US Atlantic Margin
• Coordinates
  • Lat. (^o): 39.54345
  • Long. (^o): -72.3998
  • Depth (m): 541

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090867	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0118735_100024383	F090867	AGGA	MNFNDGMTRKMIKLLDHTELTNTEIAEAVGVHRQDVEKFKRRRNEPTSLSDEELACTQPTDGFLYYLRGGNDGV*