Scaffold Ga0118738_102917

Overview

Basic Information

• Taxon OID: 3300009134
• Scaffold ID: Ga0118738_102917
• Source Dataset Name: Marine sediment microbial communities from methane seeps on Chincoteague Slope, US Atlantic Margin - Chincoteague Slope PC-6 397 cmbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1254
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location

• Location Name: Chincoteague Slope, US Atlantic Margin
• Coordinates
  • Lat. (^o): 37.53516667
  • Long. (^o): -74.29791667
  • Depth (m): 362

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065254	Metagenome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118738_1029172	F065254	N/A	VALNKGSEQAEKASVATETLLWGCPITNFKATLPFNRMKQFFAAFKKRPHDPALARFKGYN*