Scaffold Ga0118687_10003814

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118687_10003814

Scaffold Ga0118687_10003814

Overview

Basic Information
Taxon OID	3300009124 Open in IMG/M
Scaffold ID	Ga0118687_10003814 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5267
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (31.25%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location
Location Name	Hudson Canyon, US Atlantic Margin
Coordinates	Lat. (^o)	39.54345	Long. (^o)	-72.3998	Alt. (m)		Depth (m)	541.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058099	Metagenome / Metatranscriptome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118687_1000381413	F058099	N/A	MTKQLLISQLRKGNNGQQIIEILELLASGVDVCESSQDLLPTLDEIQF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.