NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0117941_1000146

Scaffold Ga0117941_1000146


Overview

Basic Information
Taxon OID3300009120 Open in IMG/M
Scaffold IDGa0117941_1000146 Open in IMG/M
Source Dataset NameLake sediment microbial communities from Tanners Lake, St. Paul, MN
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Minnesota - Twin Cities
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23529
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (76.47%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities

Source Dataset Sampling Location
Location NameTanners Lake, St. Paul, MN
CoordinatesLat. (o)44.953471Long. (o)-92.97875Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021566Metagenome / Metatranscriptome218Y

Sequences

Protein IDFamilyRBSSequence
Ga0117941_10001467F021566GGAGGMFTCTDSDRYTTRILAGLVLAVTIVVGSLTHAVSNLQTFA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.