Scaffold Ga0066256_1002017

Overview

Basic Information

• Taxon OID: 3300009070
• Scaffold ID: Ga0066256_1002017
• Source Dataset Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 24150
• Total Scaffold Genes: 28
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 19 (67.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location

• Location Name: Cape Town, South Africa
• Coordinates
  • Lat. (^o): -33.927
  • Long. (^o): 18.452665

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013535	Metagenome / Metatranscriptome	270	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066256_100201717	F013535	GGAGG	MTFEFSLLIVYRLLAFGVAAAMVWVVLRDRDWRSQVFAAMVMIPFALRAAGLK*