Scaffold Ga0103751_1025606

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103751_1025606

Scaffold Ga0103751_1025606

Overview

Basic Information
Taxon OID	3300008994 Open in IMG/M
Scaffold ID	Ga0103751_1025606 Open in IMG/M
Source Dataset Name	Microbial communities of red sea marine sponge, Stylissa carteri from the coast of Thuwal, Saudi Arabia - rep 1
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Wuerzburg
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	714
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Red Sea Marine Sponge, Stylissa Carteri From The Coast Of Thuwal, Saudi Arabia

Source Dataset Sampling Location
Location Name	coast of Thuwal, Saudi Arabia
Coordinates	Lat. (^o)	22.23	Long. (^o)	39.03	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035204	Metagenome / Metatranscriptome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103751_10256061	F035204	N/A	MPPCKPVFQVIESGCDGENLVKLSMETTVLNVHYVIHIVGFHV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.