Scaffold Ga0103751_1018961

Overview

Basic Information

• Taxon OID: 3300008994
• Scaffold ID: Ga0103751_1018961
• Source Dataset Name: Microbial communities of red sea marine sponge, Stylissa carteri from the coast of Thuwal, Saudi Arabia - rep 1
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wuerzburg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 827
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Red Sea Marine Sponge, Stylissa Carteri From The Coast Of Thuwal, Saudi Arabia

Source Dataset Sampling Location

• Location Name: coast of Thuwal, Saudi Arabia
• Coordinates
  • Lat. (^o): 22.23
  • Long. (^o): 39.03

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010384	Metagenome / Metatranscriptome	304	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103751_10189613	F010384	GGTGG	MQLRLGIWKRFVRSLLVVDRISLSWRSGRGLLEIDYWWTESASAGDLEEIY*