| Basic Information | |
|---|---|
| Taxon OID | 3300008994 Open in IMG/M |
| Scaffold ID | Ga0103751_1004151 Open in IMG/M |
| Source Dataset Name | Microbial communities of red sea marine sponge, Stylissa carteri from the coast of Thuwal, Saudi Arabia - rep 1 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wuerzburg |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1639 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Red Sea Marine Sponge, Stylissa Carteri From The Coast Of Thuwal, Saudi Arabia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | coast of Thuwal, Saudi Arabia | |||||||
| Coordinates | Lat. (o) | 22.23 | Long. (o) | 39.03 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020857 | Metagenome / Metatranscriptome | 221 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103751_10041512 | F020857 | GGA | VPSILSAIKDWDLAATSDIFVLFLQDYCALQELLVKMNFTIAVAPPFVHPMTSLPAMPTHSVRKYGFFSEPTWRRQVAKYGNLKHCESLSFSGDIESLEPSKF* |
| ⦗Top⦘ |