NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103751_1002003

Scaffold Ga0103751_1002003


Overview

Basic Information
Taxon OID3300008994 Open in IMG/M
Scaffold IDGa0103751_1002003 Open in IMG/M
Source Dataset NameMicrobial communities of red sea marine sponge, Stylissa carteri from the coast of Thuwal, Saudi Arabia - rep 1
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wuerzburg
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2180
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Red Sea Marine Sponge, Stylissa Carteri From The Coast Of Thuwal, Saudi Arabia

Source Dataset Sampling Location
Location Namecoast of Thuwal, Saudi Arabia
CoordinatesLat. (o)22.23Long. (o)39.03Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063409Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0103751_10020033F063409N/APPCSLAKFIFNETAAVQGIIIQPCSGIVTDSIQAIMQLLQGVVTYMSPVEAFATGIKNFDRWKLSLIAPF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.