| Basic Information | |
|---|---|
| Taxon OID | 3300008958 Open in IMG/M |
| Scaffold ID | Ga0104259_1021257 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from eastern North Pacific Ocean - P1 particle-associated |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Georgia |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 649 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities From Seawater In Eastern North Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | eastern North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006424 | Metagenome / Metatranscriptome | 373 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104259_10212571 | F006424 | N/A | LEIGITALGSGWVNTVFVRYDFPEFGTDLVSALSSLNMYDY |
| ⦗Top⦘ |