| Basic Information | |
|---|---|
| Taxon OID | 3300008955 Open in IMG/M |
| Scaffold ID | Ga0104273_100643 Open in IMG/M |
| Source Dataset Name | Marine bacterioplankton communities from the North Sea island Helgoland off the German coast - probe E228 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Marine Microbiology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 822 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Marine Bacterioplankton Communities From The North Sea Island Helgoland Off The German Coast |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Sea off the coast of Germany | |||||||
| Coordinates | Lat. (o) | 54.18194 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002629 | Metagenome / Metatranscriptome | 542 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104273_1006432 | F002629 | N/A | MEVNKAAWEKLKKQIEYHTQQDSEITDVLINYQVKQGKKNYLKLNITIDDFTN* |
| ⦗Top⦘ |