Scaffold Ga0104273_100306

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0104273_100306

Scaffold Ga0104273_100306

Overview

Basic Information
Taxon OID	3300008955 Open in IMG/M
Scaffold ID	Ga0104273_100306 Open in IMG/M
Source Dataset Name	Marine bacterioplankton communities from the North Sea island Helgoland off the German coast - probe E228
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Max Planck Institute for Marine Microbiology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1179
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Marine Bacterioplankton Communities From The North Sea Island Helgoland Off The German Coast

Source Dataset Sampling Location
Location Name	North Sea off the coast of Germany
Coordinates	Lat. (^o)	54.18194	Long. (^o)	7.9	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053569	Metagenome / Metatranscriptome	141	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0104273_1003062	F053569	GGAG	MTDIYLEALSDLHKLWEYSNPYCKKLNAEKHSAYKKAALKIIDAIDRGDT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.