| Basic Information | |
|---|---|
| Taxon OID | 3300008922 Open in IMG/M |
| Scaffold ID | Ga0103487_1002073 Open in IMG/M |
| Source Dataset Name | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NB2 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Sodertorn University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1645 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water → Microbial Communities Of Nutrient Treated Water From Blanes Bay, Barcelona, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Barcelona, Spain | |||||||
| Coordinates | Lat. (o) | 41.666 | Long. (o) | 2.8 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045106 | Metagenome / Metatranscriptome | 153 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103487_10020737 | F045106 | N/A | NVLFIEEFIEILGGDNFFLCDSIHQEQLFTMQDKLAKLIADHANNGTSVARHLVPLLPNTFNVE* |
| ⦗Top⦘ |