| Basic Information | |
|---|---|
| Taxon OID | 3300008920 Open in IMG/M |
| Scaffold ID | Ga0103485_100245 Open in IMG/M |
| Source Dataset Name | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NA2 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Sodertorn University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1928 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water → Microbial Communities Of Nutrient Treated Water From Blanes Bay, Barcelona, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Barcelona, Spain | |||||||
| Coordinates | Lat. (o) | 41.666 | Long. (o) | 2.8 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097453 | Metagenome / Metatranscriptome | 104 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103485_1002451 | F097453 | GGAG | MYDLILRDVEEVFGASPWSSLNIKTYPVNYQGSKGSSTEYVLINVLPSSSRNYAYGVKKETTGLVAVKIFVKAGDGQGRLMAIANSLDTVLDNKTLSNGTKLGTSYLTVEGLDPANKSLYSASYII |
| ⦗Top⦘ |