Scaffold Ga0103483_1002042

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103483_1002042

Scaffold Ga0103483_1002042

Overview

Basic Information
Taxon OID	3300008918 Open in IMG/M
Scaffold ID	Ga0103483_1002042 Open in IMG/M
Source Dataset Name	Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - KB2
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Sodertorn University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	979
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water → Microbial Communities Of Nutrient Treated Water From Blanes Bay, Barcelona, Spain

Source Dataset Sampling Location
Location Name	Barcelona, Spain
Coordinates	Lat. (^o)	41.666	Long. (^o)	2.8	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097453	Metagenome / Metatranscriptome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103483_10020422	F097453	N/A	LGASPWSSLNIKTYPVNYQGSKGSSTEYVLINVLPSSSRNYAYGVKKETTGLVAVKIFVKAGDGQGRLMAIANSLDTVLDNKTLSNGTKLGTSYLTVEGLDPANKSLYSASYIIPFTHYGE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.