| Basic Information | |
|---|---|
| Taxon OID | 3300008886 Open in IMG/M |
| Scaffold ID | Ga0115930_1095252 Open in IMG/M |
| Source Dataset Name | Microbial communities associated with unicellular green alga Micrasterias crux-melitensis, Germany - (MZCH: 98) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | HPI Heinrich-Pette-Institut |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 594 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Micrasterias Crux-Melitensis (Mzch 98) Associated → Microbial Communities Associated With Unicellular Green Alga Micrasterias Crux-Melitensis, Germany - (Mzch: 98) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany | |||||||
| Coordinates | Lat. (o) | 53.560155 | Long. (o) | 9.859606 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012765 | Metagenome / Metatranscriptome | 277 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115930_10952521 | F012765 | N/A | ERSHRFTMEELDNQRRQLQESSDEVTRLAQLLSAKDTTIKGLRASKKSIAQELETAQQAVKVAEEAAVIFKAQRDKALDKAIRAGRILMRRPGVVVPEDIRADVNAAPDSSSRPSSSVVPEKDIGK* |
| ⦗Top⦘ |