Scaffold Ga0115930_1070973

Overview

Basic Information

• Taxon OID: 3300008886
• Scaffold ID: Ga0115930_1070973
• Source Dataset Name: Microbial communities associated with unicellular green alga Micrasterias crux-melitensis, Germany - (MZCH: 98)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: HPI Heinrich-Pette-Institut
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 741
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Micrasterias Crux-Melitensis (Mzch 98) Associated → Microbial Communities Associated With Unicellular Green Alga Micrasterias Crux-Melitensis, Germany - (Mzch: 98)

Source Dataset Sampling Location

• Location Name: Germany
• Coordinates
  • Lat. (^o): 53.560155
  • Long. (^o): 9.859606

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002471	Metagenome / Metatranscriptome	556	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115930_10709732	F002471	N/A	APMASSAKKNHAFMYHDRRQTRNAYRSYNAYDDFDSHAMFASSSSYMHGRNMSRRNAIHHVPRKNIIHAPRKVMNEPSTIYRALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKDICTNLVGPNKSWVPKSQA*