NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115930_1066168

Scaffold Ga0115930_1066168


Overview

Basic Information
Taxon OID3300008886 Open in IMG/M
Scaffold IDGa0115930_1066168 Open in IMG/M
Source Dataset NameMicrobial communities associated with unicellular green alga Micrasterias crux-melitensis, Germany - (MZCH: 98)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterHPI Heinrich-Pette-Institut
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)780
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Micrasterias Crux-Melitensis (Mzch 98) Associated → Microbial Communities Associated With Unicellular Green Alga Micrasterias Crux-Melitensis, Germany - (Mzch: 98)

Source Dataset Sampling Location
Location NameGermany
CoordinatesLat. (o)53.560155Long. (o)9.859606Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096850Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0115930_10661682F096850N/ADSKTSEVLSPSAIIGTSKNEKVPAATPKRKRMANVLDVLETIISSSTPPKKAAVTFETTAEAEAGPSEPSKAKTLESEAKKITKPTFAEGTGVVTPEASPIIRDYIFRHASGKKLSEKEEQEAQHYAQKLKYPKGALIFNGSGEEDFLYCLPDSKEISVCREMSRSFGFPTLEDGLSVLSKNDLADSLAYNSLKVRQMEFLYFC*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.