Scaffold Ga0103898_100295

Overview

Basic Information

• Taxon OID: 3300008880
• Scaffold ID: Ga0103898_100295
• Source Dataset Name: Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_3059
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Massachusetts Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 785
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001926	Metagenome / Metatranscriptome	616	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103898_1002952	F001926	N/A	VRHEDIPDMSNPKTTKAVLEGDKLMKEVLNGGYNVHPVPPPNSETKERSARKYERKRTKIEKLFTLGYTTSGDP*