Scaffold Ga0103389_101301

Overview

Basic Information

• Taxon OID: 3300008876
• Scaffold ID: Ga0103389_101301
• Source Dataset Name: Microbial communities of Wadden Sea tidal flat in Germany - 1650 earlyLowTide
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Bielefeld University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 892
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Tidal Flat → Microbial Communities Of Wadden Sea Tidal Flat In Germany

Source Dataset Sampling Location

• Location Name: Wadden Sea, Germany
• Coordinates
  • Lat. (^o): 53.73
  • Long. (^o): 7.67

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017955	Metagenome / Metatranscriptome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103389_1013011	F017955	GAG	MLNASFEADWQFIRERKQRLIVQNNKRENAKRAPHTYNVGDTVVVKAGMQSKHGHAPYLGPMRITQVYDNGTVKLIKVADNNGGAVSQTWNIRNIEPRKA*