| Basic Information | |
|---|---|
| Taxon OID | 3300008875 Open in IMG/M |
| Scaffold ID | Ga0103388_104535 Open in IMG/M |
| Source Dataset Name | Microbial communities of Wadden Sea tidal flat in Germany - 1450 fallingTide |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Bielefeld University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 507 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Tidal Flat → Microbial Communities Of Wadden Sea Tidal Flat In Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Wadden Sea, Germany | |||||||
| Coordinates | Lat. (o) | 53.73 | Long. (o) | 7.67 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082131 | Metagenome / Metatranscriptome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103388_1045351 | F082131 | N/A | MTNAGRPSPCSHHIDIQHFALQEWKHRGDTLMEHIPGIINPADGLTKPLGWVLHHHHSCCLMGHFGLPLVAAAA* |
| ⦗Top⦘ |