| Basic Information | |
|---|---|
| Taxon OID | 3300008870 Open in IMG/M |
| Scaffold ID | Ga0103382_1001351 Open in IMG/M |
| Source Dataset Name | Microbial communities from dairy cow rumen, for metatranscriptome studies - 6180_rapeseed oil diet |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Aarhus University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 572 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities From Dairy Cow Rumen, For Metatranscriptome Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011364 | Metagenome / Metatranscriptome | 291 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103382_10013512 | F011364 | AGGA | MVIDSEVNERDEGIFYLLPSEMSKSGLLNPEKFDSCDIRNVEVDDIRPSALLGILSSLKPNGRVTVTLCEPIAVMQPYEARMVEANAKLAGFVDIQTSPGTFFNKFSNQEDETLVVTFTKPERPR |
| ⦗Top⦘ |