NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103380_1001605

Scaffold Ga0103380_1001605


Overview

Basic Information
Taxon OID3300008850 Open in IMG/M
Scaffold IDGa0103380_1001605 Open in IMG/M
Source Dataset NameMicrobial communities from dairy cow rumen, for metatranscriptome studies - 6021_rapeseed oil diet
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterAarhus University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)542
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Sordariales → Chaetomiaceae → Thermothelomyces → Thermothelomyces thermophilus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities From Dairy Cow Rumen, For Metatranscriptome Studies

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014928Metagenome / Metatranscriptome259Y

Sequences

Protein IDFamilyRBSSequence
Ga0103380_10016051F014928N/APVIHKEIQQIVHENVQPVITKEIQPIVNTKIQPVIHREVQQIIHKDVQPIITTQIQPIINKKIQPVIHKEIQPIIHKDIQEVITTNVQPIINQKIQPVIHKEIQPVIHKDIQPIVTTQIQPIINKKIQPVIHKEIQPIIHEDVQPVITTNVQKIINRQIQPVFQNRIKNVVTKEVDKIDT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.