Scaffold Ga0103895_10012

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103895_10012

Scaffold Ga0103895_10012

Overview

Basic Information
Taxon OID	3300008847 Open in IMG/M
Scaffold ID	Ga0103895_10012 Open in IMG/M
Source Dataset Name	Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2927
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Massachusetts Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	966
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre

Source Dataset Sampling Location
Location Name	North Pacific Ocean
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090441	Metatranscriptome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103895_100121	F090441	N/A	EFFFFFEVWELATLSFLDSLALGALITRRVIVGCQFPDAVSYRKNDSDMFRSHSGT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.