NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008847

3300008847: Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2927



Overview

Basic Information
IMG/M Taxon OID3300008847 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117986 | Gp0126484 | Ga0103895
Sample NameMicrobial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2927
Sequencing StatusPermanent Draft
Sequencing CenterMassachusetts Institute of Technology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1305521
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysurface water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090440Metagenome / Metatranscriptome108N
F090441Metatranscriptome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103895_10012Not Available966Open in IMG/M
Ga0103895_10126Not Available558Open in IMG/M
Ga0103895_10155Not Available530Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103895_10012Ga0103895_100121F090441EFFFFFEVWELATLSFLDSLALGALITRRVIVGCQFPDAVSYRKNDSDMFRSHSGT*
Ga0103895_10126Ga0103895_101262F090440GNEISGLKLATDLRLKRIYHCRVTDVGEDYVLRIIILKSIGG*
Ga0103895_10155Ga0103895_101551F090441GVEPYLFPIWSFFFFFGEVWELATLSFPDSLALGALITRRVIVGCQFPDAASYRKNDCDMFRFHSGT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.