Basic Information | |
---|---|
Taxon OID | 3300008807 Open in IMG/M |
Scaffold ID | Ga0115888_124002 Open in IMG/M |
Source Dataset Name | Wastewater viral communities from SBR reactor in SCELSE, Singapore - ContigAbv1k |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 8873 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinaceae → Methanococcoides → unclassified Methanococcoides → Methanococcoides sp. AM1 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Sbr_Wastewater → Role Of Bacteriophages In Aerobic Granulation |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.345254 | Long. (o) | 103.678179 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082719 | Metagenome / Metatranscriptome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115888_1240026 | F082719 | AGGAG | MARGQDFITLARQHNKAIWDGINALVAMQREWNALDYGNTLPDGEGSNADYTADEIGAVVFDTANAFVTVLNAGHATNMSKLL* |
⦗Top⦘ |